Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH, Human (HEK293, His)

PTH Protein, or parathyroid hormone, raises calcium levels by dissolving bone salts and inhibiting kidney excretion. It also stimulates [1-14C]-2-deoxy-D-glucose transport and glycogen synthesis in osteoblastic cells, interacting with the PTH1R receptor and binding to its N-terminal extracellular domain for these effects. PTH Protein, Human (HEK293, His) is the recombinant human-derived PTH protein, expressed by HEK293 , with N-8*His labeled tag.

Product Specifications

Product Name Alternative

PTH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pth-protein-human-hek-293-his.html

Purity

95.75

Smiles

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Molecular Formula

5741 (Gene_ID) P01270 (S32-Q115) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIST1H3A Antibody
orb752816-01 50 μL

HIST1H3A Antibody

Sign In for Pricing
View Details
HIST1H3A Antibody
orb752816-02 100 µL

HIST1H3A Antibody

Sign In for Pricing
View Details
Hdhd2 ORF Vector (Mouse) (pORF)
ORF047061 1.0 µg DNA

Hdhd2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rat Pwwp2b Pre-designed siRNA Set A
SI211415A 1 Each

Rat Pwwp2b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Schaedler Broth 100 ml Bottle
TMB_SCH_F100_1 100 mL Bottle

Schaedler Broth 100 ml Bottle

Sign In for Pricing
View Details
hsa-let-7g-3p miRNA Antagomir
MNH01021 2x 5.0 nmol

hsa-let-7g-3p miRNA Antagomir

Sign In for Pricing
View Details