Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H2AC4, Human

The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

H2AC4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/h2ac4-protein-human.html

Smiles

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Molecular Formula

3012 (Gene_ID) P04908 (S2-K130) (Accession)

Molecular Weight

Approximately 14.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Megf10 sgRNA CRISPR Lentivector set (Rat)
K7189801 3x 1.0 µg

Megf10 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
2- (2-bromo-5-methoxyphenyl) ethan-1-amine
KLB38102-01 100 mg

2- (2-bromo-5-methoxyphenyl) ethan-1-amine

Sign In for Pricing
View Details
2- (2-bromo-5-methoxyphenyl) ethan-1-amine
KLB38102-02 1 g

2- (2-bromo-5-methoxyphenyl) ethan-1-amine

Sign In for Pricing
View Details
Coq3 (NM_019187) Rat Untagged Clone
RN210591 10 µg

Coq3 (NM_019187) Rat Untagged Clone

Sign In for Pricing
View Details
ZFP36L2 AAV siRNA Pooled Vector
50942161 1.0 µg

ZFP36L2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ZEB1 Antibody - N-terminal region
ARP32422_P050-25UL 25 µL

ZEB1 Antibody - N-terminal region

Sign In for Pricing
View Details