H2AC4, Human
The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
H2AC4 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/h2ac4-protein-human.html
Smiles
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Molecular Formula
3012 (Gene_ID) P04908 (S2-K130) (Accession)
Molecular Weight
Approximately 14.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6381407-01 0.1 mL
HMOX1 (Heme Oxygenase-1, Heme Oxygenase 1, HO-1, HO, HO1) (PE)
Sign In for Pricing
View Details MBS6381407-02 5x 0.1 mL
HMOX1 (Heme Oxygenase-1, Heme Oxygenase 1, HO-1, HO, HO1) (PE)
Sign In for Pricing
View Details