H2AC4, Human
The H2AC4 protein is a core component of nucleosomes, which compress DNA into chromatin and restrict DNA entry into cellular processes. H2AC4 Protein, Human is the recombinant human-derived H2AC4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
H2AC4 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/h2ac4-protein-human.html
Smiles
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Molecular Formula
3012 (Gene_ID) P04908 (S2-K130) (Accession)
Molecular Weight
Approximately 14.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CSB-EP846108HU1(F2)(M2)-01 20 µg
Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D) , partial
Sign In for Pricing
View Details CSB-EP846108HU1(F2)(M2)-02 100 µg
Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D) , partial
Sign In for Pricing
View Details CSB-EP846108HU1(F2)(M2)-03 1 mg
Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D) , partial
Sign In for Pricing
View Details 
IMSAHUCD35E11CPECY5100 100 Tests
Anti Human CD35 Flow Cytometry Monoclonal Clone E11 PE/Cyanine5 Ready To Use 100 Tests
Sign In for Pricing
View Details