Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme C (Gzmc)

Product Specifications

Product Name Alternative

B10 (Cytotoxic cell protease 2) (CCP2)

Abbreviation

Recombinant Mouse Gzmc protein

Gene Name

Gzmc

UniProt

P08882

Expression Region

21-248aa

Organism

Mus musculus (Mouse)

Target Sequence

IIGGNEISPHSRPYMAYYEFLKVGGKKMFCGGFLVRDKFVLTAAHCKGSSMTVTLGAHNIKAKEETQQIIPVAKAIPHPDYNPDDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECYVAGWGKVTPDGEFPKTLHEVKLTVQKDQVCESQFQSSYNRANEICVGDSKIKGASFEEDSGGPLVCKRAAAGIVSYGQTDGSAPQVFTRVLSFVSWIKKTMKHS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal VCL / Vinculin Antibody (C-Terminus)
APR03275G 0.05mg

Polyclonal VCL / Vinculin Antibody (C-Terminus)

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-01 48 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-02 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-03 5x 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit
MBS721338-04 10x 96 Well

Mouse tumor necrosis factor-related apoptosis inducing ligand 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Salmonella typhimurium (strain LT2/SGSC1412/700720) hisD Polyclonal Antibody
MBS7151822 Inquire

Rabbit anti-Salmonella typhimurium (strain LT2/SGSC1412/700720) hisD Polyclonal Antibody

Sign In for Pricing
View Details