Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein B-100/APOB, Human (His, solution)

Apolipoprotein B-100/Apo B Protein, Human (His, solution) expresses in E. coli with a His tag at the N-terminus. Human Apolipoprotein B-100 (apo B-100) is the major apolipoprotein of low density lipoproteins and the principal ligand for interaction with the low density lipoprotein receptor[1].

Product Specifications

Product Name Alternative

Apolipoprotein B-100/APOB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-b-100-apo-b-protein-human-his.html

Purity

95.0

Smiles

HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Molecular Formula

338 (Gene_ID) P04114 (E28-S127) (Accession)

Molecular Weight

Approximately 16.0 kDa

References & Citations

[1]Law SW, et al. Human apolipoprotein B-100: cloning, analysis of liver mRNA, and assignment of the gene to chromosome 2. Proc Natl Acad Sci U S A. 1985 Dec;82 (24) :8340-4.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL9P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1896806 1.0 µg DNA

RPL9P18 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GAGE12H Human Gene Knockout Kit (CRISPR)
KN414378 1 Kit

GAGE12H Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PBEF Rabbit mAb
E60M3891 100 µL

PBEF Rabbit mAb

Sign In for Pricing
View Details
Acetyl-Histone H3 (K14) Antibody, mAb, Rabbit
A02666-50 50 µL

Acetyl-Histone H3 (K14) Antibody, mAb, Rabbit

Sign In for Pricing
View Details
IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15)
247410 50 µg

IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15)

Sign In for Pricing
View Details
FRAP Reagent B, 1.4ML
C149-1.4ML 1.4ML

FRAP Reagent B, 1.4ML

Sign In for Pricing
View Details