Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein B-100/APOB, Human (His, solution)

Apolipoprotein B-100/Apo B Protein, Human (His, solution) expresses in E. coli with a His tag at the N-terminus. Human Apolipoprotein B-100 (apo B-100) is the major apolipoprotein of low density lipoproteins and the principal ligand for interaction with the low density lipoprotein receptor[1].

Product Specifications

Product Name Alternative

Apolipoprotein B-100/APOB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-b-100-apo-b-protein-human-his.html

Purity

95.0

Smiles

HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Molecular Formula

338 (Gene_ID) P04114 (E28-S127) (Accession)

Molecular Weight

Approximately 16.0 kDa

References & Citations

[1]Law SW, et al. Human apolipoprotein B-100: cloning, analysis of liver mRNA, and assignment of the gene to chromosome 2. Proc Natl Acad Sci U S A. 1985 Dec;82 (24) :8340-4.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl (2e) -3- (4-fluorophenyl) acrylate
PC907942-01 100 mg

Ethyl (2e) -3- (4-fluorophenyl) acrylate

Sign In for Pricing
View Details
Ethyl (2e) -3- (4-fluorophenyl) acrylate
PC907942-02 1 g

Ethyl (2e) -3- (4-fluorophenyl) acrylate

Sign In for Pricing
View Details
Ethyl (2e) -3- (4-fluorophenyl) acrylate
PC907942-03 5 g

Ethyl (2e) -3- (4-fluorophenyl) acrylate

Sign In for Pricing
View Details
Ethyl (2e) -3- (4-fluorophenyl) acrylate
PC907942-04 25 g

Ethyl (2e) -3- (4-fluorophenyl) acrylate

Sign In for Pricing
View Details
Olr1564 siRNA Oligos set (Rat)
34041176 3x 5 nmol

Olr1564 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
INA Antibody
MBS8515536-01 0.1 mg

INA Antibody

Sign In for Pricing
View Details