Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gymnema sylvestre Gurmarin

Product Specifications

Product Name Alternative

(Sweet taste-suppressing peptide)

Abbreviation

Recombinant Gymnema sylvestre Gurmarin protein

UniProt

P25810

Expression Region

1-35aa

Organism

Gymnema sylvestre (Gurmar) (Periploca sylvestris)

Target Sequence

QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.6 kDa

References & Citations

"High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KP10 + KIP2/880), CF640R conjugate, 0.1mg/mL
BNC401015-100 1x 100 µL

P57 / KIP2 (KP10 + KIP2/880), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF647 conjugate, 0.1mg/mL
BNC470053-500 1x 500 µL

HCG-alpha (HCGa/53), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (MACIF/629), CF647 conjugate, 0.1mg/mL
BNC470629-100 1x 100 µL

CD59 (heavy chain of Protectin) (MACIF/629), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL
BNC681025-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26 + 57), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details