Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART4/CD297, Rat (HEK293, His)

ART4/CD297 is a predicted NAD+ ADP-ribosyltransferase that exhibits biased expression in tissues such as the adrenal gland and thymus. As an ortholog of human ART4, it is involved in peptidyl arginine ADP ribosylation. ART4/CD297 Protein, Rat (HEK293, His) is the recombinant rat-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ART4/CD297 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/art4-cd297-protein-rat-hek293-his.html

Purity

96.00

Smiles

GSAEAALKVDVDLTPGSFDDQYRGCSKQVLEELNQGDYFVREIDTHKYYSRAWQKAHLTWLNQATSLPESMTPVHAVAILVFTLNLNVSSDFAKAMTRASGSPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNGSPCYRVHHRMKDVNIEANVGSTVRFGQFLSASLLKEETQVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKNCSLKGDLINLRSAGNVSRYNCQLLK

Molecular Formula

312806 (Gene_ID) F1MA10/NP_001166980 (G30-K269) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details