Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ART4/CD297, Rat (HEK293, His)

ART4/CD297 is a predicted NAD+ ADP-ribosyltransferase that exhibits biased expression in tissues such as the adrenal gland and thymus. As an ortholog of human ART4, it is involved in peptidyl arginine ADP ribosylation. ART4/CD297 Protein, Rat (HEK293, His) is the recombinant rat-derived ART4/CD297 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ART4/CD297 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/art4-cd297-protein-rat-hek293-his.html

Purity

96.00

Smiles

GSAEAALKVDVDLTPGSFDDQYRGCSKQVLEELNQGDYFVREIDTHKYYSRAWQKAHLTWLNQATSLPESMTPVHAVAILVFTLNLNVSSDFAKAMTRASGSPGQYRQSFHFKYLHYYLTSAIQLLRKESSTKNGSPCYRVHHRMKDVNIEANVGSTVRFGQFLSASLLKEETQVSGNQTLFTIFTCLGASVQDFSLRKEVLIPPYELFEVVSKNCSLKGDLINLRSAGNVSRYNCQLLK

Molecular Formula

312806 (Gene_ID) F1MA10/NP_001166980 (G30-K269) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mtbp Pre-designed siRNA Set B
SI208784B 1 Each

Rat Mtbp Pre-designed siRNA Set B

Sign In for Pricing
View Details
Olfr148 Mouse shRNA Plasmid (Locus ID 258498)
TL507745 1 Kit

Olfr148 Mouse shRNA Plasmid (Locus ID 258498)

Sign In for Pricing
View Details
PARP16 sgRNA CRISPR Lentivector (Human) (Target 1)
K1596802 1.0 µg DNA

PARP16 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CLLD7 (RCBTB1) (NM_018191) Human Tagged Lenti ORF Clone
RC214169L4 10 µg

CLLD7 (RCBTB1) (NM_018191) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human SLC30A8 Protein, N-His
HV761012-01 50 µg

Recombinant Human SLC30A8 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SLC30A8 Protein, N-His
HV761012-02 100 µg

Recombinant Human SLC30A8 Protein, N-His

Sign In for Pricing
View Details