Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER3, Human (HEK293, His)

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Human (HEK293, His) is the recombinant human-derived HER3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HER3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/her3-protein-human-hek-293-his.html

Purity

98.00

Smiles

SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT

Molecular Formula

2065 (Gene_ID) P21860-1 (S20-T643) (Accession)

Molecular Weight

86-100 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-Ceramide synthase 2 Polyclonal Antibody
MF-0072119-01 50 µL

Anti-Ceramide synthase 2 Polyclonal Antibody

Ask
View Details
Anti-Ceramide synthase 2 Polyclonal Antibody
MF-0072119-02 100 µL

Anti-Ceramide synthase 2 Polyclonal Antibody

Ask
View Details
Anti-Ceramide synthase 2 Polyclonal Antibody
MF-0072119-03 200 µL

Anti-Ceramide synthase 2 Polyclonal Antibody

Ask
View Details
NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (APC) discontinued
039053-APC 200 µL

NOLC1, NT (NOLC1, KIAA0035, NS5ATP13, Nucleolar and coiled-body phosphoprotein 1, 140kD nucleolar phosphoprotein, Hepatitis C virus NS5A-transactivated protein 13, Nucleolar 130kD protein, Nucleolar phosphoprotein p130) (APC) discontinued

Ask
View Details
Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate
LH20031V 100 µg

Cytochrome p450 2C19 (CYP2C19) (NM_000769) Human Over-expression Lysate

Ask
View Details
Rno-miR-193b-3p miRNA Inhibitor
CIR0734-01 10 nmol

Rno-miR-193b-3p miRNA Inhibitor

Ask
View Details