Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER3, Human (HEK293, His)

HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Human (HEK293, His) is the recombinant human-derived HER3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HER3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/her3-protein-human-hek-293-his.html

Purity

98.00

Smiles

SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLT

Molecular Formula

2065 (Gene_ID) P21860-1 (S20-T643) (Accession)

Molecular Weight

86-100 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Basic Fibroblast Growth Factor 9 ELISA Kit
MBS040516-01 48 Well

Canine Basic Fibroblast Growth Factor 9 ELISA Kit

Ask
View Details
Canine Basic Fibroblast Growth Factor 9 ELISA Kit
MBS040516-02 96 Well

Canine Basic Fibroblast Growth Factor 9 ELISA Kit

Ask
View Details
Canine Basic Fibroblast Growth Factor 9 ELISA Kit
MBS040516-03 5x 96 Well

Canine Basic Fibroblast Growth Factor 9 ELISA Kit

Ask
View Details
Canine Basic Fibroblast Growth Factor 9 ELISA Kit
MBS040516-04 10x 96 Well

Canine Basic Fibroblast Growth Factor 9 ELISA Kit

Ask
View Details
Panx3 (NM_172454) Mouse Tagged ORF Clone Lentiviral Particle
MR206122L4V 200 µL

Panx3 (NM_172454) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit
GA-E0917MS-01 48 Tests

Mouse Secreted Frizzled Related Protein 5 (SFRP5) ELISA Kit

Ask
View Details