Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR2, Mouse (N-His, C-Myc)

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

CCR2 Protein, Mouse (N-His, C-Myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccr2-protein-mouse-n-his-c-myc.html

Purity

93.00

Smiles

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Molecular Formula

12772 (Gene_ID) P51683 (M1-A55) (Accession)

Molecular Weight

16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2,3-Dimethylphenyl) -1H-imidazol-5-ylmethanone
419849-01 250 mg

(2,3-Dimethylphenyl) -1H-imidazol-5-ylmethanone

Sign In for Pricing
View Details
(2,3-Dimethylphenyl) -1H-imidazol-5-ylmethanone
419849-02 1 g

(2,3-Dimethylphenyl) -1H-imidazol-5-ylmethanone

Sign In for Pricing
View Details
Human Peroxiredoxin 1 (PRDX1) ELISA Kit
RDR-PRDX1-Hu-96Tests 96 Tests

Human Peroxiredoxin 1 (PRDX1) ELISA Kit

Sign In for Pricing
View Details
Rb Lentiviral Activation Particles (r2)
sc-437319-LAC-2 200 µL

Rb Lentiviral Activation Particles (r2)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen
MBS9421048-01 0.02 mg

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen
MBS9421048-02 0.1 mg

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen

Sign In for Pricing
View Details