Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR2, Mouse (N-His, C-Myc)

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

CCR2 Protein, Mouse (N-His, C-Myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccr2-protein-mouse-n-his-c-myc.html

Purity

93.00

Smiles

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Molecular Formula

12772 (Gene_ID) P51683 (M1-A55) (Accession)

Molecular Weight

16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CXCL15/Lungkine DuoSet ELISA
DY442 15 Plates

Mouse CXCL15/Lungkine DuoSet ELISA

Ask
View Details
Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1062703-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1062703-02 0.02 mg (Yeast)

Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1062703-03 0.1 mg (E-Coli)

Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1062703-04 0.1 mg (Yeast)

Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details
Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1062703-05 0.02 mg (Baculovirus)

Recombinant Corynebacterium glutamicum Imidazole glycerol phosphate synthase subunit HisF (hisF)

Ask
View Details