Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR2, Mouse (N-His, C-Myc)

CCR2 protein is an important chemokine receptor that coordinates chemotaxis and migration by binding to CCL2, CCL7, and CCL12 and activating the PI3K cascade. In addition to chemokine signaling, CCR2 regulates T cell inflammatory cytokines, promotes Th17 cell generation, and promotes mature thymocyte output. CCR2 Protein, Mouse (N-His, C-Myc) is the recombinant mouse-derived CCR2 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

CCR2 Protein, Mouse (N-His, C-Myc), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccr2-protein-mouse-n-his-c-myc.html

Purity

93.00

Smiles

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Molecular Formula

12772 (Gene_ID) P51683 (M1-A55) (Accession)

Molecular Weight

16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit
MBS7200028-01 48 Well

Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit

Ask
View Details
Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit
MBS7200028-02 96 Well

Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit

Ask
View Details
Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit
MBS7200028-03 5x 96 Well

Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit

Ask
View Details
Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit
MBS7200028-04 10x 96 Well

Human NF kappa B inhibitor Alpha (NFKBIA) ELISA Kit

Ask
View Details
Rat tRNA-specific adenosine deaminase-like protein 3 (ADAT3) ELISA Kit
abx501052 96 Tests

Rat tRNA-specific adenosine deaminase-like protein 3 (ADAT3) ELISA Kit

Ask
View Details
Recombinant Human SLAMF7 Protein
CRP2314-01 10 µg

Recombinant Human SLAMF7 Protein

Ask
View Details