Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Aspartate Aminotransferase -Mitochondrial (GOT2) Antibody
31335-05111 150 µg

Human Aspartate Aminotransferase -Mitochondrial (GOT2) Antibody

Sign In for Pricing
View Details
KCNIP4 Antibody
A58608-50UG 50 µg

KCNIP4 Antibody

Sign In for Pricing
View Details
Vonlerolizumab
MF-0100581-01 1 mg

Vonlerolizumab

Sign In for Pricing
View Details
Vonlerolizumab
MF-0100581-02 5 mg

Vonlerolizumab

Sign In for Pricing
View Details
RPL26P36 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1952207 1.0 µg DNA

RPL26P36 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rnf181 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4121903 1.0 µg DNA

Rnf181 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details