Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP1 gamma Mouse Monoclonal Antibody
E38QA8260 100 µL

PP1 gamma Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ANKIB1 Protein Vector (Human) (pPM-C-HA)
PV062195 500 ng

ANKIB1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CNOT1 Rabbit Polyclonal Antibody
E28PN5735 100 µL

CNOT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Coronin 2B, CORO2B ELISA KIT
E0816Ra-01 48 Well

Rat Coronin 2B, CORO2B ELISA KIT

Sign In for Pricing
View Details
Rat Coronin 2B, CORO2B ELISA KIT
E0816Ra-02 96 Well

Rat Coronin 2B, CORO2B ELISA KIT

Sign In for Pricing
View Details
Rat Coronin 2B, CORO2B ELISA KIT
E0816Ra-03 5x 96 Tests

Rat Coronin 2B, CORO2B ELISA KIT

Sign In for Pricing
View Details