Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORCTL2 CRISPR/Cas9 KO Plasmid (m)
sc-422070 20 µg

ORCTL2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
PGA5 Antibody
F40041-0.08ML 0.08 mL

PGA5 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fads1 shRNA (UAS) - Lentiviral mouse Fads1 shRNA (UAS, iRFP) (100)
GTR15304158 1 Vial

Lentiviral mouse Fads1 shRNA (UAS) - Lentiviral mouse Fads1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Guinea Pig SRPX2 ELISA Kit
EGS0181 96 Tests

Guinea Pig SRPX2 ELISA Kit

Sign In for Pricing
View Details
SJPYT-310
MF-0113796-01 10 mg

SJPYT-310

Sign In for Pricing
View Details
SJPYT-310
MF-0113796-02 50 mg

SJPYT-310

Sign In for Pricing
View Details