Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAI18 3'UTR GFP Stable Cell Line
TU076848 1.0 mL

TRNAI18 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
N, N'-Diphenylguanidine-d10
460120 1 mg

N, N'-Diphenylguanidine-d10

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-4490 Virus
mh6488 1.0 mL

AdmiRa-Off-hsa-miR-4490 Virus

Sign In for Pricing
View Details
C20orf30 ORF Vector (Human) (pORF)
ORF001494 1.0 µg DNA

C20orf30 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ADAM29 Knockout HAP1 Polyclonal Cells
ARG21628 1 Million

ADAM29 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Anti-Phospho-PIK3C3 (Ser282) Polyclonal Antibody
MF-0086313-01 50 µL

Anti-Phospho-PIK3C3 (Ser282) Polyclonal Antibody

Sign In for Pricing
View Details