Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chrm3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7528307 1.0 µg DNA

Chrm3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Ganglioside-induced differentiation-associated protein 1-Like 1 (GDAP1L1) Mouse ELISA Kit
D6169 96 Tests

Ganglioside-induced differentiation-associated protein 1-Like 1 (GDAP1L1) Mouse ELISA Kit

Sign In for Pricing
View Details
OXGR1/GPR80 Rabbit pAb
E47R17577 100 µL

OXGR1/GPR80 Rabbit pAb

Sign In for Pricing
View Details
TRBP Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61820R-BF350-01 20 µL

TRBP Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
TRBP Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61820R-BF350-02 100 µL

TRBP Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
BOD1 siRNA (Rat)
MBS8219156-01 15 nmol

BOD1 siRNA (Rat)

Sign In for Pricing
View Details