Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody
AP02498PU-S 50 µL

ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Adenylosuccinate synthetase isozyme 2,ADSS ELISA KIT
JOT-EK7097Hu 96 wells

Human Adenylosuccinate synthetase isozyme 2,ADSS ELISA KIT

Sign In for Pricing
View Details
Diroximel fumarate 5mg
A20797-5 5 mg

Diroximel fumarate 5mg

Sign In for Pricing
View Details
Trappc9 (NM_001164643) Mouse Tagged ORF Clone Lentiviral Particle
MR225137L4V 200 µL

Trappc9 (NM_001164643) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fndc8 (NM_001107030) Rat Tagged ORF Clone
RR202097 10 µg

Fndc8 (NM_001107030) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PPLK/GFP+Puro-CREB1 shRNA (3+1)
PPL00586-3 1 Each

PPLK/GFP+Puro-CREB1 shRNA (3+1)

Sign In for Pricing
View Details