Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal SOX17 Antibody (internal region)
APR14409G 0.1 mg

Polyclonal SOX17 Antibody (internal region)

Sign In for Pricing
View Details
Elf3 (NM_001163131) Mouse Tagged Lenti ORF Clone
MR223180L3 10 µg

Elf3 (NM_001163131) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Chicken Beta-enolase (ENO3), N-His-GST
AP1C312-01 1 mg

Recombinant Chicken Beta-enolase (ENO3), N-His-GST

Sign In for Pricing
View Details
Recombinant Chicken Beta-enolase (ENO3), N-His-GST
AP1C312-02 100 µg

Recombinant Chicken Beta-enolase (ENO3), N-His-GST

Sign In for Pricing
View Details
Recombinant Chicken Beta-enolase (ENO3), N-His-GST
AP1C312-03 200 µg

Recombinant Chicken Beta-enolase (ENO3), N-His-GST

Sign In for Pricing
View Details
Recombinant Chicken Beta-enolase (ENO3), N-His-GST
AP1C312-04 5 mg

Recombinant Chicken Beta-enolase (ENO3), N-His-GST

Sign In for Pricing
View Details