Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Sheep (P. pastoris, His)

TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Sheep (P. pastoris, His), Sheep, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-sheep-p-pastoris-his.html

Smiles

LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Molecular Formula

443540 (Gene_ID) P23383 (L78-L234) (Accession)

Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmc1 ORF Vector (Mouse) (pORF)
ORF041626 1.0 µg DNA

Cmc1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse IL-33 Recombinant Rabbit monoclonal Antibody
HA723863 100 µL

Mouse IL-33 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Goat anti Chicken proteins
MBS573503-01 1 mL

Goat anti Chicken proteins

Sign In for Pricing
View Details
Goat anti Chicken proteins
MBS573503-02 5x 1 mL

Goat anti Chicken proteins

Sign In for Pricing
View Details
Mouse Monoclonal Pin1 Antibody (3G8) [Janelia Fluor 549]
NBP1-22956JF549 0.1 mL

Mouse Monoclonal Pin1 Antibody (3G8) [Janelia Fluor 549]

Sign In for Pricing
View Details
MAPK6 (NM_002748) Human Tagged ORF Clone Lentiviral Particle
RC201597L2V 200 µL

MAPK6 (NM_002748) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details