Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IKZF1 Antibody / IKAROS

DNA-binding protein Ikaros is a protein that in humans is encoded by the IKZF1 gene. This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.5-1 µg/mL

UniProt

Q13422

Host

Mouse

Reactivity

Human

Immunogen

Amino acids 428-459 (LKEEHRAYDLLRAASENSQDALRVVSTSGEQM) from the human protein were used as the immunogen for the IKZF1 antibody.

Clonality

Monoclonal

Isotype

IgG1

Clone

5F12H7

Applications

WB

Purity

Antigen affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose

Reconstitution

After reconstitution, the IKZF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This IKZF1 antibody is available for research use only.

Storage Conditions

After reconstitution, the IKZF1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the IKZF1 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) Daudi, 2) Jurkat, 3) Raji and 4) K562 cell lysate with IKZF1 antibody. Expected molecular weight: ~65/55 kDa (isoforms 1/2) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM190A (CCSER1) activation kit by CRISPRa
GA118312 1 Kit

Human FAM190A (CCSER1) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS626101 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), Biotin conjugate, 0.1mg/mL
BNCB1856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Dromedary camel coronavirus (DcCoV) (strain HKU23-368F) Nucleoprotein / DcCoV-NP Protein (His Tag)
PKSV030134 100 µg

Recombinant Dromedary camel coronavirus (DcCoV) (strain HKU23-368F) Nucleoprotein / DcCoV-NP Protein (His Tag)

Sign In for Pricing
View Details
LRCH1 Human Gene Knockout Kit (CRISPR)
KN416574 1 Kit

LRCH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details