Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human

HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human.html

Purity

97.93

Smiles

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (D63-L148) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Raab G, et al. Heparin-binding EGF-like growth factor. Biochim Biophys Acta. 1997 Dec 9;1333 (3) :F179-99.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: B-E3]
AM31220AF-N 200 µg

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: B-E3]

Sign In for Pricing
View Details
Human DERA activation kit by CRISPRa
GA109537 1 Kit

Human DERA activation kit by CRISPRa

Sign In for Pricing
View Details
Human WASH1 (WASHC1) activation kit by CRISPRa
GA119206 1 Kit

Human WASH1 (WASHC1) activation kit by CRISPRa

Sign In for Pricing
View Details
all-cis-4,7,10,13,16-Docosapentaenoic Acid
TRC-A014954-2.5MG 2.5 mg

all-cis-4,7,10,13,16-Docosapentaenoic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Nose
CS704091 5x 5 µm

Tissue FFPE Sections, Nose

Sign In for Pricing
View Details
N-Acetyl-S-(trichlorovinyl)-L-cysteine
TRC-A189580-25MG 25 mg

N-Acetyl-S-(trichlorovinyl)-L-cysteine

Sign In for Pricing
View Details