Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human

HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human.html

Purity

97.93

Smiles

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (D63-L148) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Raab G, et al. Heparin-binding EGF-like growth factor. Biochim Biophys Acta. 1997 Dec 9;1333 (3) :F179-99.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: OTI2A2]
CF808293 100 µg

Prostate Specific Antigen (KLK3) Mouse Monoclonal Antibody [Clone ID: OTI2A2]

Sign In for Pricing
View Details
rac Alminoprofen
TRC-A575150-1G 1 g

rac Alminoprofen

Sign In for Pricing
View Details
5-Aza Cytosine-15N4
TRC-A796377-1MG 1 mg

5-Aza Cytosine-15N4

Sign In for Pricing
View Details
3-(4-Hydroxy-[1,1'-biphenyl]-3-yl)propanoic Acid
TRC-H817620-100MG 100 mg

3-(4-Hydroxy-[1,1'-biphenyl]-3-yl)propanoic Acid

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF640R conjugate, 0.1mg/mL
BNC401629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethacrynic Acid Epoxide
TRC-E676005-250MG 250 mg

Ethacrynic Acid Epoxide

Sign In for Pricing
View Details