Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human

HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human.html

Purity

97.93

Smiles

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (D63-L148) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Raab G, et al. Heparin-binding EGF-like growth factor. Biochim Biophys Acta. 1997 Dec 9;1333 (3) :F179-99.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fenamiphos 90%
TRC-F245700-500MG 500 mg

Fenamiphos 90%

Sign In for Pricing
View Details
Cytokeratin, HMW (KRTH/1076), CF594 conjugate, 0.1mg/mL
BNC941076-100 1x 100 µL

Cytokeratin, HMW (KRTH/1076), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IHPK3 (IP6K3) Human Gene Knockout Kit (CRISPR)
KN420137 1 Kit

IHPK3 (IP6K3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NF1 Antibody
KC-24900-01 50 μL

NF1 Antibody

Sign In for Pricing
View Details
NF1 Antibody
KC-24900-02 100 µL

NF1 Antibody

Sign In for Pricing
View Details
NF1 Antibody
KC-24900-03 1 mL

NF1 Antibody

Sign In for Pricing
View Details