Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HB-EGF, Human

HB-EGF Protein, Human is a member of the epidermal growth factor (EGF) family of growth factors that stimulate growth and differentiation.

Product Specifications

Product Name Alternative

HB-EGF Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hb-egf-protein-human.html

Purity

97.93

Smiles

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Formula

1839 (Gene_ID) Q99075 (D63-L148) (Accession)

Molecular Weight

Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Raab G, et al. Heparin-binding EGF-like growth factor. Biochim Biophys Acta. 1997 Dec 9;1333 (3) :F179-99.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF488A conjugate, 0.1mg/mL
BNC881058-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF146 Recombinant Rabbit Monoclonal Antibody [PSH0-29]
HA721309 100 µL

RNF146 Recombinant Rabbit Monoclonal Antibody [PSH0-29]

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) (NM_001159936) Human Over-expression Lysate
LC431320 20 µg

EBNA1 binding protein 2 (EBNA1BP2) (NM_001159936) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Myeloid tissue
CB630656 1 Block

Frozen Tissue Blocks, Myeloid tissue

Sign In for Pricing
View Details
Human C7orf23 (TMEM243) activation kit by CRISPRa
GA112395 1 Kit

Human C7orf23 (TMEM243) activation kit by CRISPRa

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), 0.2mg/mL
BNUB2386-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), 0.2mg/mL

Sign In for Pricing
View Details