Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial

Product Specifications

Product Name Alternative

B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Abbreviation

Recombinant Mouse Ms4a1 protein, partial

Gene Name

Ms4a1

UniProt

P19437

Expression Region

132-291aa

Organism

Mus musculus (Mouse)

Target Sequence

ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

This protein may be involved in the regulation of B-cell activation and proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This protein may be involved in the regulation of B-cell activation and proliferation.

Molecular Weight

20.1 kDa

References & Citations

The oligomeric nature of the murine Fc epsilon RII/CD23. Implications for function.Dierks S.E., Bartlett W.C., Edmeades R.L., Gould H.J., Rao M., Conrad D.H.J. Immunol. 150:2372-2382 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIN9 (NM_173083) Human Untagged Clone
SC101037 10 µg

LIN9 (NM_173083) Human Untagged Clone

Sign In for Pricing
View Details
SSX1 Human Gene Knockout Kit (CRISPR)
KN401600 1 Kit

SSX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RSPH10B2 (NM_001099697) Human Tagged ORF Clone
RG221344 10 µg

RSPH10B2 (NM_001099697) Human Tagged ORF Clone

Sign In for Pricing
View Details
Samd9l (NM_010156) Mouse Untagged Clone
MC224715 10 µg

Samd9l (NM_010156) Mouse Untagged Clone

Sign In for Pricing
View Details
TDRD3 Human Pre-designed siRNA Set A
HY-RS14336 1 Set

TDRD3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Janelia Fluor 635]
NBP3-24051JF635 0.1 mL

Rabbit Monoclonal GFAP Antibody (GFAP/8255R) [Janelia Fluor 635]

Sign In for Pricing
View Details