Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A12, Human

The S100A12 protein is a calcium, zinc, and copper binder that regulates inflammation and immune responses. As a DAMP molecule, it activates innate immune cells through AGER, triggering pro-inflammatory pathways. S100A12 Protein, Human is the recombinant human-derived S100A12 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

S100A12 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a12-protein-human.html

Purity

97.00

Smiles

MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Molecular Formula

6283 (Gene_ID) P80511 (M1-E92) (Accession)

Molecular Weight

Approximately 11.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLFNL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV680986 1.0 µg DNA

SLFNL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
PTHrP (Parathyroid Hormone Related Protein)
053330 200 µL

PTHrP (Parathyroid Hormone Related Protein)

Sign In for Pricing
View Details
Lentiviral mouse Rgs19 shRNA (UAS) - Lentiviral mouse Rgs19 shRNA (UAS, RFP) (100)
GTR15263052 1 Vial

Lentiviral mouse Rgs19 shRNA (UAS) - Lentiviral mouse Rgs19 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ASFV Wild Strain and Gene-deleted Vaccine Strain Real Time PCR Dual Detection kit
BSL27M1 48 Tests

ASFV Wild Strain and Gene-deleted Vaccine Strain Real Time PCR Dual Detection kit

Sign In for Pricing
View Details
RRN6 Antibody
orb849426 2 mg

RRN6 Antibody

Sign In for Pricing
View Details
VANGL2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
49423126 3x 1.0µg DNA

VANGL2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details