Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nanog Recombinant Protein

Product Specifications

Background

Nanog is a homeodomain-containing transcription factor that is essential for the maintenance of pluripotency and self renewal in embryonic stem cells. Nanog expression is controlled by a network of factors including Sox2 and the key pluripotency regulator Oct-4. Recent advances in somatic cell reprogramming have utilized viral expression of combinations of transcription factors including nanog, Oct-4, Sox2, KLF4, c-Myc, and LIN28.

CAS Number

9000-83-3

Swiss Prot

Q9H9S0

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

0.5M Urea, PH7.4

Molecular Weight

~40kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3,4-Difluorobenzyl) -1H-pyrrole
PC300001 1 Each

1- (3,4-Difluorobenzyl) -1H-pyrrole

Sign In for Pricing
View Details
CD272 Rabbit Polyclonal Antibody (BF350)
orb2557182 100 µL

CD272 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RAB3IL1 Peptide - middle region (AAP56739)
AAP56739-100UG 100 µg

RAB3IL1 Peptide - middle region (AAP56739)

Sign In for Pricing
View Details
[KO Validated] NNMT Rabbit pAb (APR29582N)
APR29582N-01 50 µL

[KO Validated] NNMT Rabbit pAb (APR29582N)

Sign In for Pricing
View Details
[KO Validated] NNMT Rabbit pAb (APR29582N)
APR29582N-02 100 µL

[KO Validated] NNMT Rabbit pAb (APR29582N)

Sign In for Pricing
View Details
[KO Validated] NNMT Rabbit pAb (APR29582N)
APR29582N-03 200 µL

[KO Validated] NNMT Rabbit pAb (APR29582N)

Sign In for Pricing
View Details