Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A44R Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q3I957

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

2M Urea, PH7.4

Molecular Weight

~18kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMDKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Almitrine Bismesylate
TRC-A575153-250MG 250 mg

Almitrine Bismesylate

Sign In for Pricing
View Details
Collagen V (COL5A3) Human Gene Knockout Kit (CRISPR)
KN422823 1 Kit

Collagen V (COL5A3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse LTF/LF Antibody Pair Set
E-KAB-0088 50 µL & 100 µg

Mouse LTF/LF Antibody Pair Set

Sign In for Pricing
View Details
CIKS (TRAF3IP2) Rabbit Polyclonal Antibody
TA382776 100 µL

CIKS (TRAF3IP2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Slc16a6 Mouse Gene Knockout Kit (CRISPR)
KN515892 1 Kit

Slc16a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 10 (LH2), CF647 conjugate, 0.1mg/mL
BNC470674-500 1x 500 µL

Cytokeratin 10 (LH2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details