Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A44R Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q3I957

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

2M Urea, PH7.4

Molecular Weight

~18kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMDKIKITIDSKIGNVVTISYNLEKITIDVTPKKKKEKDVLLAQSVAVEEAKDVKVEEKNIIDIEDDDDMDIENTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinamide
TRC-R243000-1MG 1 mg

Retinamide

Sign In for Pricing
View Details
CD104 (UM-A9), 0.2mg/mL
BNUB0449-100 1x 100 µL

CD104 (UM-A9), 0.2mg/mL

Sign In for Pricing
View Details
Cpne3 Mouse Gene Knockout Kit (CRISPR)
KN503764 1 Kit

Cpne3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF740 conjugate, 0.1mg/mL
BNC743416-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) Human Gene Knockout Kit (CRISPR)
KN400165 1 Kit

Gemin 8 (GEMIN8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Clobetasone 17-Propionate
TRC-C583535-10MG 10 mg

Clobetasone 17-Propionate

Sign In for Pricing
View Details