Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D14L Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q77HN7

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag; Sumo-Tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

2M Urea, PH7.4

Molecular Weight

~37kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMKVESVTFLTLLGIGCVLSYCTIPSRPINMKFKNSVETDANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTGWTLFNQCIKRRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYIDGSIVTYSCNSGYSLIGNSGVMCSGGEWSNPPTCQIVKCPHPISNGKLLAALE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Monoclonal CD23/Fc epsilon RII Antibody (FCER2/6474R) [Janelia Fluor 585]
NBP3-24172JF585 0.1 mL

Rabbit Monoclonal CD23/Fc epsilon RII Antibody (FCER2/6474R) [Janelia Fluor 585]

Ask
View Details
SDR39U1 Protein Lysate (Mouse) with C-HA Tag
43272034 100 µg

SDR39U1 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
Mouse Monoclonal Integrin alpha 3/CD49c Antibody (MM0416-2C39) [Alexa Fluor 594]
NBP2-11737AF594 0.1 mL

Mouse Monoclonal Integrin alpha 3/CD49c Antibody (MM0416-2C39) [Alexa Fluor 594]

Ask
View Details
DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 750)
MBS6472700-01 0.1 mL

DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 750)

Ask
View Details
DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 750)
MBS6472700-02 5x 0.1 mL

DR3, ED (Wsl-1, Apo-3, TRAMP, LARD1-5, Death Receptor3) (MaxLight 750)

Ask
View Details
ECE1 Antibody (Center) Blocking Peptide
MBS9226382-01 0.5 mg

ECE1 Antibody (Center) Blocking Peptide

Ask
View Details