Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A Recombinant Protein

Product Specifications

Background

TCL1 (T cell leukemia 1), MTCP1 and TCL1b belong to the TCL1 proto-oncogene family, and their products are involved in Akt activation during embryonic development, T cell leukemias, prolymphocytic leukemias and B cell lymphomas. The Akt association domain of TCL1 binds with the PH domain of Akt. The formation of an oligomeric TCL-Akt complex is required for TCL1 coactivator function and results in phosphorylation and activation of Akt . Furthermore, functional analysis indicates that the interaction between TCL1 and Akt promotes translocation of Akt to the nucleus. These findings are supported by the crystal structure of TCL1, which suggests that TCL1 may participate in molecular transport.

CAS Number

9000-83-3

Swiss Prot

P56279

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

0.5M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TRAF5 (E-5) : m-IgG Fc BP-HRP Bundle
sc-539534 1 Kit

TRAF5 (E-5) : m-IgG Fc BP-HRP Bundle

Ask
View Details
Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)
MBS2099703-01 5x 96 Tests

Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)

Ask
View Details
Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)
MBS2099703-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)

Ask
View Details
Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)
MBS2099703-03 10x 96 Tests

Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)

Ask
View Details
Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)
MBS2099703-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Cluster Of Differentiation 6 (CD6) Antibody Pair Kit (with Standard)

Ask
View Details
Rabbit Polyclonal DKFZP434B168 Antibody [Allophycocyanin]
NB100-465APC 0.1 mL

Rabbit Polyclonal DKFZP434B168 Antibody [Allophycocyanin]

Ask
View Details