Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A Recombinant Protein

Product Specifications

Background

TCL1 (T cell leukemia 1), MTCP1 and TCL1b belong to the TCL1 proto-oncogene family, and their products are involved in Akt activation during embryonic development, T cell leukemias, prolymphocytic leukemias and B cell lymphomas. The Akt association domain of TCL1 binds with the PH domain of Akt. The formation of an oligomeric TCL-Akt complex is required for TCL1 coactivator function and results in phosphorylation and activation of Akt . Furthermore, functional analysis indicates that the interaction between TCL1 and Akt promotes translocation of Akt to the nucleus. These findings are supported by the crystal structure of TCL1, which suggests that TCL1 may participate in molecular transport.

CAS Number

9000-83-3

Swiss Prot

P56279

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

0.5M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEGS1 Polyclonal Antibody, Cy5 Conjugated
bs-4057R-Cy5 100 µL

DEGS1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Biglycan Polyclonal Antibody, Cy7 Conjugated
bs-7552R-Cy7-01 20 µL

Biglycan Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Biglycan Polyclonal Antibody, Cy7 Conjugated
bs-7552R-Cy7-02 100 µL

Biglycan Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal ACT11 Antibody (mAb2345a) [Biotin]
NBP2-53120B 0.1 mL

Mouse Monoclonal ACT11 Antibody (mAb2345a) [Biotin]

Sign In for Pricing
View Details
Human Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT
ELI-42809h 96 Tests

Human Vacuolar fusion protein MON1 homolog A, MON1A ELISA KIT

Sign In for Pricing
View Details
Mps1-IN-1 dihydrochloride
MBS5812638 Inquire

Mps1-IN-1 dihydrochloride

Sign In for Pricing
View Details