Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A Recombinant Protein

Product Specifications

Background

TCL1 (T cell leukemia 1), MTCP1 and TCL1b belong to the TCL1 proto-oncogene family, and their products are involved in Akt activation during embryonic development, T cell leukemias, prolymphocytic leukemias and B cell lymphomas. The Akt association domain of TCL1 binds with the PH domain of Akt. The formation of an oligomeric TCL-Akt complex is required for TCL1 coactivator function and results in phosphorylation and activation of Akt . Furthermore, functional analysis indicates that the interaction between TCL1 and Akt promotes translocation of Akt to the nucleus. These findings are supported by the crystal structure of TCL1, which suggests that TCL1 may participate in molecular transport.

CAS Number

9000-83-3

Swiss Prot

P56279

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

0.5M Urea, PH7.4

Molecular Weight

~17kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIP30 (FAM192A) (NM_024946) Human Tagged ORF Clone Lentiviral Particle
RC204378L2V 200 µL

NIP30 (FAM192A) (NM_024946) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MeCP2 Rabbit Polyclonal Antibody
E28PB2084 100 µL

MeCP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (FITC)
F0025-92-FITC 200 µL

FCGR2C, CT (CD32, CDw32, Fc-gamma RII-c, Fc-gamma-RIIc, FcRII-c, Low Affinity Immunoglobulin gamma Fc Region Receptor II-c, IgG Fc Receptor II-c, CD32, FCG2, IGFR2) (FITC)

Sign In for Pricing
View Details
UNC5B Antibody
R35840-100UG 100 µg

UNC5B Antibody

Sign In for Pricing
View Details
KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (MaxLight 750) discontinued
248032-ML750 100 µL

KRT6B (Keratin 6B, CK6B, K6B, KRTL1, PC2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Atr 3'UTR GFP Stable Cell Line
TU152378 1.0 mL

Atr 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details