What is the catalog number for M1R Recombinant Protein?

The catalog number for M1R Recombinant Protein is NCP0418.

What sizes are available for M1R Recombinant Protein?

M1R Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does M1R Recombinant Protein come in?

M1R Recombinant Protein is available in 2 different pack sizes.

Is M1R Recombinant Protein in stock?

M1R Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

M1R Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q80KX3

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag; Sumo-Tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~31kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGLE