A33R Recombinant Protein
Product Specifications
Background
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
CAS Number
9000-83-3
Swiss Prot
Q3I8L8
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~16kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
HMASILNTLRFLEKTSFYNCNDSITKEKIKIKHKGMSFVFYKPKHSTVVKYLSGGGIYHDDLVVLGKVTINDLKMMLFYMDLSYHGVTSSGAIYKLGSSIDRLSLNRTIVTKVNNNYNNYNNYNNYNCYNNYNCYNYDDTFFDDDDLE
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
46920126 3x 1.0µg DNA
TMEM156 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details 
MBS5798149 Inquire
Biotin-Amyloid-beta (1-42) Peptide (trifluoroacetate salt)
Sign In for Pricing
View Details GTR15144542 1 Vial
Lentiviral human MTRNR2L10 shRNA (UAS) - Lentiviral human MTRNR2L10 shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details