Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3L Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q3I8S1

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag; Sumo-Tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFLE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SNTG1 (NM_018967) Human Recombinant Protein
PH36941M5 20 µg

SNTG1 (NM_018967) Human Recombinant Protein

Ask
View Details
NR3C2, ID (NR3C2, MCR, MLR, Mineralocorticoid receptor, Nuclear receptor subfamily 3 group C member 2) (PE)
MBS6326665-01 0.2 mL

NR3C2, ID (NR3C2, MCR, MLR, Mineralocorticoid receptor, Nuclear receptor subfamily 3 group C member 2) (PE)

Ask
View Details
NR3C2, ID (NR3C2, MCR, MLR, Mineralocorticoid receptor, Nuclear receptor subfamily 3 group C member 2) (PE)
MBS6326665-02 5x 0.2 mL

NR3C2, ID (NR3C2, MCR, MLR, Mineralocorticoid receptor, Nuclear receptor subfamily 3 group C member 2) (PE)

Ask
View Details
RPL35A siRNA (Rat)
CRR1550-01 15 nmol

RPL35A siRNA (Rat)

Ask
View Details
RPL35A siRNA (Rat)
CRR1550-02 30 nmol

RPL35A siRNA (Rat)

Ask
View Details
Nlgn1 (NM_001163387) Mouse Tagged ORF Clone Lentiviral Particle
MR226628L4V 200 µL

Nlgn1 (NM_001163387) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details