Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

H3L Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q3I8S1

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag; Sumo-Tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~48kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMAAAKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFIELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISFLE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ARFIP2 (ADP-Ribosylation Factor Interacting Protein 2, POR1) (FITC)
243443-FITC 100 µL

ARFIP2 (ADP-Ribosylation Factor Interacting Protein 2, POR1) (FITC)

Ask
View Details
TPP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62830R-BF594-01 20 µL

TPP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
TPP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62830R-BF594-02 100 µL

TPP2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
Lentiviral human SPIN4 shRNA (UAS) - Lentiviral human SPIN4 shRNA (UAS) (100)
GTR15122682 1 Vial

Lentiviral human SPIN4 shRNA (UAS) - Lentiviral human SPIN4 shRNA (UAS) (100)

Ask
View Details
Genesig Real-Time PCR detection kit for Adenovirus type C, Advanced
348752 1 Kit

Genesig Real-Time PCR detection kit for Adenovirus type C, Advanced

Ask
View Details
MDM2, Phosphorylated (Thr218) (Ubiquitin-protein Ligase E3 Mdm2, p53-binding Protein Mdm2, Oncoprotein Mdm2, Double Minute 2 Protein, Hdm2) (MaxLight 490)
MBS6487486-01 0.1 mL

MDM2, Phosphorylated (Thr218) (Ubiquitin-protein Ligase E3 Mdm2, p53-binding Protein Mdm2, Oncoprotein Mdm2, Double Minute 2 Protein, Hdm2) (MaxLight 490)

Ask
View Details