Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A35R Recombinant Protein

Product Specifications

Background

Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.

CAS Number

9000-83-3

Swiss Prot

Q80KX2

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~14kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

HMVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crl Antibody
orb812250 2 mg

Crl Antibody

Sign In for Pricing
View Details
{4-[ (2-Oxo-1,2-dihydropyridin-1-yl) methyl]phenyl}boronic acid
JDC17277-01 100 mg

{4-[ (2-Oxo-1,2-dihydropyridin-1-yl) methyl]phenyl}boronic acid

Sign In for Pricing
View Details
{4-[ (2-Oxo-1,2-dihydropyridin-1-yl) methyl]phenyl}boronic acid
JDC17277-02 1 g

{4-[ (2-Oxo-1,2-dihydropyridin-1-yl) methyl]phenyl}boronic acid

Sign In for Pricing
View Details
Human Alpha-1-antitrypsin,SERPINA1 ELISA KIT
JOT-EK0753Hu-01 48 Well

Human Alpha-1-antitrypsin,SERPINA1 ELISA KIT

Sign In for Pricing
View Details
Human Alpha-1-antitrypsin,SERPINA1 ELISA KIT
JOT-EK0753Hu-02 96 Well

Human Alpha-1-antitrypsin,SERPINA1 ELISA KIT

Sign In for Pricing
View Details
CPN10 Rabbit pAb, AP conjugated
orb2884054 100 µL

CPN10 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details