A35R Recombinant Protein
Product Specifications
Background
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
CAS Number
9000-83-3
Swiss Prot
Q80KX2
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~14kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
HMVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCTLE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15342203 1 Vial
Lentiviral human TIPIN shRNA (UAS) - Lentiviral human TIPIN shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details EK2F423-01 48 Test
Bovine Protein Phosphatase 1B (PPM1B) ELISA Kit-Sandwich
Sign In for Pricing
View Details EK2F423-02 96 Tests
Bovine Protein Phosphatase 1B (PPM1B) ELISA Kit-Sandwich
Sign In for Pricing
View Details 034618-Biotin 200 µL
DHRS2, CT (DHRS2, Dehydrogenase/reductase SDR family member 2, Dicarbonyl reductase HEP27, Protein D) (Biotin) discontinued
Sign In for Pricing
View Details