A29L Recombinant Protein
Product Specifications
Background
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
CAS Number
9000-83-3
Swiss Prot
Q9YN60
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~12kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
HMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYELE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A03674-3-FITC 100 µg/Vial
Anti-PSGL-1/Selplg Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details VAng-Cr4879-50gEcoli 50 µg (E. coli)
Recombinant Klebsiella Pneumoniae hutI Protein (aa 1-405)
Sign In for Pricing
View Details 
305565-01 50 µg
GALM (Aldose 1-epimerase, Galactose Mutarotase) (HRP)
Sign In for Pricing
View Details 305565-02 100 µg
GALM (Aldose 1-epimerase, Galactose Mutarotase) (HRP)
Sign In for Pricing
View Details 359633-01 48 Tests
VEGFD (Vascular Endothelial cell Growth Factor D) BioAssayTM ELISA Kit (Mouse) discontinued
Sign In for Pricing
View Details