Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD303 Recombinant Protein

Product Specifications

Background

Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal (beta1-3/4) GlcNAc (beta1-2) Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium.

CAS Number

9000-83-3

Swiss Prot

Q8WTT0

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~23kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMC7 (F-3) Alexa Fluor® 680
sc-514440 AF680 200 µg/mL

EMC7 (F-3) Alexa Fluor® 680

Sign In for Pricing
View Details
IRF2BP1 Human shRNA Plasmid Kit (Locus ID 26145)
TL317083 1 Kit

IRF2BP1 Human shRNA Plasmid Kit (Locus ID 26145)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)
MBS7038225-01 0.02 mg

Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)
MBS7038225-02 0.1 mg

Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)

Sign In for Pricing
View Details
Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)
MBS7038225-03 5x 0.1 mg

Recombinant Kineococcus radiotolerans UPF0060 membrane protein Krad_3114 (Krad_3114)

Sign In for Pricing
View Details
Vinyl Decanoate
OR1028439-01 5 mL

Vinyl Decanoate

Sign In for Pricing
View Details