CD301 Recombinant Protein
Product Specifications
Background
Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.
CAS Number
9000-83-3
Swiss Prot
Q8IUN9
Modification Site
NdeI-XhoI
Expression System
Pet-22b (+)
Tag
His-tag
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~30kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only, not for use in diagnostic procedure.
Host or Source
E.coli
AA Sequence
QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H-8201-1 1 mg
HRP Conjugated Amaranthus caudatus Lectin (Tassel flowerInca wheat) -ACA-
Sign In for Pricing
View Details 
![FITC Conjugated Mouse PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH05-04]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea817e0/imageurl/ha720213f.webp)
HA720213F 100 µL
FITC Conjugated Mouse PD-L1 Recombinant Rabbit Monoclonal Antibody [PSH05-04]
Sign In for Pricing
View Details 
GP-1301-15 1 mL
Colloidal Gold Conjugated Glycine max Lectin (Soybean) -SBA-, 15nm
Sign In for Pricing
View Details 
BNC432615-100 1x 100 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![(11beta,17alpha)-17-[(Ethoxycarbonyl)oxy]-11-hydroxy-3-oxo-androsta-1,4-diene-17-carboxylic acid](https://cdn.genprice.uk/products/572/8902852721874/imageurl/trc-e890570-250mg.webp)
TRC-E890570-250MG 250 mg
(11beta,17alpha)-17-[(Ethoxycarbonyl)oxy]-11-hydroxy-3-oxo-androsta-1,4-diene-17-carboxylic acid
Sign In for Pricing
View Details