Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD301 Recombinant Protein

Product Specifications

Background

Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.

CAS Number

9000-83-3

Swiss Prot

Q8IUN9

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~30kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Over-expression Lysate
LC422590 20 µg

Casein Kinase 1 alpha (CSNK1A1) (NM_001025105) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UE-01 25 µg

APC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
APC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UE-02 100 µg

APC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
Tmem35a (NM_026239) Mouse Tagged ORF Clone
MG201366 10 µg

Tmem35a (NM_026239) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Streptavidin, Allophycocyanin Crosslinked Conjugate, 0.5 mg/ml
#29048-200uL 1x 200 µL

Streptavidin, Allophycocyanin Crosslinked Conjugate, 0.5 mg/ml

Sign In for Pricing
View Details
Shroom 3 (SHROOM3) Human Gene Knockout Kit (CRISPR)
KN423652 1 Kit

Shroom 3 (SHROOM3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details