Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD301 Recombinant Protein

Product Specifications

Background

Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.

CAS Number

9000-83-3

Swiss Prot

Q8IUN9

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~30kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf26 (DYNAP) (N-term) Rabbit Polyclonal Antibody
AP50504PU-N 400 µL

C18orf26 (DYNAP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rab39b Mouse Gene Knockout Kit (CRISPR)
KN514362 1 Kit

Rab39b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
a-Chloralose ("may contain up to xx % of beta anomer")
TRC-A576005-2.5G 2.5 g

a-Chloralose ("may contain up to xx % of beta anomer")

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS507889 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
ERK 1 Monoclonal Antibody
E-AB-22247-01 20 µL

ERK 1 Monoclonal Antibody

Sign In for Pricing
View Details
ERK 1 Monoclonal Antibody
E-AB-22247-02 60 µL

ERK 1 Monoclonal Antibody

Sign In for Pricing
View Details