Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD212 Recombinant Protein

Product Specifications

Background

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

CAS Number

9000-83-3

Swiss Prot

P42701

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~52kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ARG2 Antibody (OTI3G5) [Alexa Fluor 350]
NBP2-70205AF350 0.1 mL

Mouse Monoclonal ARG2 Antibody (OTI3G5) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human Cyclophilin 40 ELISA Kit (Colorimetric)
NBP2-60549 1 Kit

Human Cyclophilin 40 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (Biotin)
F0019-58V7A-Biotin 100 µL

FANCC (Fanconi Anemia Group C Protein, Protein FACC, FAC, FACC) (Biotin)

Sign In for Pricing
View Details
PPAPDC1B (PLPP5) (NM_001102560) Human Over-expression Lysate
LY420157 100 µg

PPAPDC1B (PLPP5) (NM_001102560) Human Over-expression Lysate

Sign In for Pricing
View Details
Gardiquimod hydrochloride
T204751-01 10 mg

Gardiquimod hydrochloride

Sign In for Pricing
View Details
Gardiquimod hydrochloride
T204751-02 50 mg

Gardiquimod hydrochloride

Sign In for Pricing
View Details