Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD212 Recombinant Protein

Product Specifications

Background

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

CAS Number

9000-83-3

Swiss Prot

P42701

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~52kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal to human Follicle-stimulating hormone for coating
orb2309049 1 mg

Monoclonal to human Follicle-stimulating hormone for coating

Sign In for Pricing
View Details
Monkey Hepcidin (Hepcidin) ELISA Kit
YP-W70990-01 48 Tests

Monkey Hepcidin (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Monkey Hepcidin (Hepcidin) ELISA Kit
YP-W70990-02 96 Tests

Monkey Hepcidin (Hepcidin) ELISA Kit

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Phosphate acetyltransferase (pta), partial
MBS1344776 Inquire

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Phosphate acetyltransferase (pta), partial

Sign In for Pricing
View Details
Anti-Factor VIII Antibody
orb1148414-01 100 µg

Anti-Factor VIII Antibody

Sign In for Pricing
View Details
Anti-Factor VIII Antibody
orb1148414-02 500 µg

Anti-Factor VIII Antibody

Sign In for Pricing
View Details