Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD85A Recombinant Protein

Product Specifications

Background

May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM) .

CAS Number

9000-83-3

Swiss Prot

O75022

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~52kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYNC1I2 (NM_001378) Human Tagged Lenti ORF Clone
RC221434L3 10 µg

DYNC1I2 (NM_001378) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HPCL2 Polyclonal Antibody, FITC Conjugated
bs-4046R-FITC 100 µL

HPCL2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Katna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7348506 1.0 µg DNA

Katna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Human NPL
MBS7611262-01 0.05 mg

Recombinant Human NPL

Sign In for Pricing
View Details
Recombinant Human NPL
MBS7611262-02 0.2 mg

Recombinant Human NPL

Sign In for Pricing
View Details
Recombinant Human NPL
MBS7611262-03 1 mg

Recombinant Human NPL

Sign In for Pricing
View Details