Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD208 Recombinant Protein

Product Specifications

Background

Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction. Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process. Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway. May also play a role in dendritic cell function and in adaptive immunity.

CAS Number

9000-83-3

Swiss Prot

Q9UQV4

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~47kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cathepsin B Antibody
MBS8323951-01 0.03 mL

Anti-Cathepsin B Antibody

Sign In for Pricing
View Details
Anti-Cathepsin B Antibody
MBS8323951-02 0.05 mL

Anti-Cathepsin B Antibody

Sign In for Pricing
View Details
Anti-Cathepsin B Antibody
MBS8323951-03 0.1 mL

Anti-Cathepsin B Antibody

Sign In for Pricing
View Details
Anti-Cathepsin B Antibody
MBS8323951-04 0.2 mL

Anti-Cathepsin B Antibody

Sign In for Pricing
View Details
Anti-Cathepsin B Antibody
MBS8323951-05 5x 0.2 mL

Anti-Cathepsin B Antibody

Sign In for Pricing
View Details
BST2 Rabbit Polyclonal Antibody (Cy5)
orb874448 100 µL

BST2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details