Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptavidin Recombinant Protein

Product Specifications

Background

The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin) .

CAS Number

9000-83-3

Swiss Prot

P22629

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~38kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinesin Heavy Chain Isoform 5C (KIF5C) Antibody
abx376904-01 50 µg

Kinesin Heavy Chain Isoform 5C (KIF5C) Antibody

Sign In for Pricing
View Details
Kinesin Heavy Chain Isoform 5C (KIF5C) Antibody
abx376904-02 100 µg

Kinesin Heavy Chain Isoform 5C (KIF5C) Antibody

Sign In for Pricing
View Details
Mouse Isthmin-1 (ISM1) ELISA Kit
orb3032764-01 48 Tests

Mouse Isthmin-1 (ISM1) ELISA Kit

Sign In for Pricing
View Details
Mouse Isthmin-1 (ISM1) ELISA Kit
orb3032764-02 96 Tests

Mouse Isthmin-1 (ISM1) ELISA Kit

Sign In for Pricing
View Details
Mouse IGFBP-5 DuoSet ELISA
DY578 15 Plates

Mouse IGFBP-5 DuoSet ELISA

Sign In for Pricing
View Details
Robatumumab (Anti-IGF1R / CD221)
A3044-1mg 1 mg

Robatumumab (Anti-IGF1R / CD221)

Sign In for Pricing
View Details