Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD62E Recombinant Protein

Product Specifications

Background

Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining.

CAS Number

9000-83-3

Swiss Prot

P16581

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~62kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit
MBS7247324-01 48 Well

Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit
MBS7247324-02 96 Well

Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit
MBS7247324-03 5x 96 Well

Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit
MBS7247324-04 10x 96 Well

Guinea pig Apolipoprotein L4 (APOL4) ELISA Kit

Sign In for Pricing
View Details
pCR4-TOPO-SERF1B-2 Plasmid
PVT31795 2 µg

pCR4-TOPO-SERF1B-2 Plasmid

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) IHFB Polyclonal Antibody
MBS7162697 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) IHFB Polyclonal Antibody

Sign In for Pricing
View Details