Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD299 Recombinant Protein

Product Specifications

Background

Dendritic cells (DC) are antigen-presenting immune system cells that are present on peripheral mucosal tissues and migrate to lymphoid tissues. DC-SIGN (DC-specific ICAM-3 grabbing nonintegrin) is a type II membrane protein that is exclusively expressed by DC. DC-SIGN, also designated CD209, binds to ICAM-3 to mediate the initial interaction between DC and resting T cells through the immunological synapse. The DC that are present in the initial sites of HIV-1 infection capture HIV-1 through DC-SIGN, which then facilitates the migration of DC to areas of T cell-rich secondary lymphoid organs, where it promotes efficient trans HIV-1 infection of these T cells. DC-SIGNR (DC-SIGNrelated molecule), also designated CD209L and L-SIGN (liver/lymph nodespecific ICAM-3 grabbing nonintegrin), is a type II integral membrane protein that is 77% identical to DC-SIGN. It is expressed on sinusoidal endothelial cells and binds the E2 glycoproteins of the hepatitis C virus.

CAS Number

9000-83-3

Swiss Prot

Q9H2X3

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~38kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-01 0.02 mg (E-Coli)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details
Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-02 0.1 mg (E-Coli)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details
Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-03 0.02 mg (Yeast)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details
Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-04 0.1 mg (Yeast)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details
Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-05 0.02 mg (Baculovirus)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details
Recombinant Pseudonaja textilis Pseudonajatoxin b
MBS1011333-06 1 mg (E-Coli)

Recombinant Pseudonaja textilis Pseudonajatoxin b

Sign In for Pricing
View Details