Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD174 Recombinant Protein

Product Specifications

Background

Glycosyltransferases that mediate the regio- and stereoselective transfer of sugars, such as the fucosyltransferases, determine cell surface-carbohydrate profiles, which is an essential interface for biological recognition processes. Fucosyltransferases catalyze the covalent association of fucose to different positional linkages in sugar acceptor molecules. The carbohydrate moieties generated and covalently attached to cell surfaces are necessary to ensure a surface contour that satisfies physiological roles, which are reliant on adhesion molecules such as selectins. Hematopoietic lineages rely on fucosyltransferases to confer a surface carbohydrate phenotype, which mediates proper cell adhesion molecule recruitment and cell trafficking. Blood Group Lewis a is a carbohydrate determinant carried on both glycolipids and glycoproteins.

CAS Number

9000-83-3

Swiss Prot

P21217

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~42kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

F2 3'UTR GFP Stable Cell Line
TU254186 1.0 mL

F2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ERR1 (Steroid Hormone Receptor ERR1)
480366 100 µL

ERR1 (Steroid Hormone Receptor ERR1)

Sign In for Pricing
View Details
Resistin (human) Serum ELISA Kit
GWB-AXR254 100 Assays

Resistin (human) Serum ELISA Kit

Sign In for Pricing
View Details
Zfp68 Protein Vector (Mouse) (pPM-C-HA)
PV250012 500 ng

Zfp68 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human IPP shRNA (UAS) - Lentiviral human IPP shRNA (UAS, GFP) plasmid
GTR15309469 1 Vial

Lentiviral human IPP shRNA (UAS) - Lentiviral human IPP shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Herc4 ORF Vector (Mouse) (pORF)
ORF047107 1.0 µg DNA

Herc4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details