Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD174 Recombinant Protein

Product Specifications

Background

Glycosyltransferases that mediate the regio- and stereoselective transfer of sugars, such as the fucosyltransferases, determine cell surface-carbohydrate profiles, which is an essential interface for biological recognition processes. Fucosyltransferases catalyze the covalent association of fucose to different positional linkages in sugar acceptor molecules. The carbohydrate moieties generated and covalently attached to cell surfaces are necessary to ensure a surface contour that satisfies physiological roles, which are reliant on adhesion molecules such as selectins. Hematopoietic lineages rely on fucosyltransferases to confer a surface carbohydrate phenotype, which mediates proper cell adhesion molecule recruitment and cell trafficking. Blood Group Lewis a is a carbohydrate determinant carried on both glycolipids and glycoproteins.

CAS Number

9000-83-3

Swiss Prot

P21217

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~42kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MRVSRDDATGSPRAPSGSSRQDTTPTRPTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSRLPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWFT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASS1, CT (ASS1, ASS, Argininosuccinate synthase, Citrulline-aspartate ligase)
032148 200 µL

ASS1, CT (ASS1, ASS, Argininosuccinate synthase, Citrulline-aspartate ligase)

Sign In for Pricing
View Details
UMPS Overexpression Lysate (Native) - (Dry Ice)
NBL1-17609 0.1 mg

UMPS Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Anti-Gc-globulin Antibody
CQA1972-01 30 µL

Anti-Gc-globulin Antibody

Sign In for Pricing
View Details
Anti-Gc-globulin Antibody
CQA1972-02 50 μL

Anti-Gc-globulin Antibody

Sign In for Pricing
View Details
Anti-Gc-globulin Antibody
CQA1972-03 100 µL

Anti-Gc-globulin Antibody

Sign In for Pricing
View Details
Anti-Gc-globulin Antibody
CQA1972-04 200 µL

Anti-Gc-globulin Antibody

Sign In for Pricing
View Details