Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD278 Recombinant Protein

Product Specifications

Background

ICOS (Inducible Co-Stimulator, CD278) is a member of the CD28 family that regulates T cell activity and immune responses. The ICOS protein contains an extracellular IgV-like domain, a transmembrane domain, and an intracellular domain with a YMFM motif. ICOS is primarily expressed on activated CD4+ and CD8+ T cells. Upon binding to its ligand, ICOS potentiates the T cell response to antigen through activation of the PI3K signaling pathway. In addition to enhancing T cell activation and proliferation, ICOS plays an important role in the regulation of T follicular helper cells. Research studies suggest that ICOS is a potential therapeutic target, and could serve as a prognostic biomarker for neoplastic therapy involving CTLA-4 blockade.

CAS Number

9000-83-3

Swiss Prot

Q9Y6W8

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~15kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinogen gamma Chain Antibody (Biotin)
KB-1686-01 50 μL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details
Fibrinogen gamma Chain Antibody (Biotin)
KB-1686-02 100 µL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details
Fibrinogen gamma Chain Antibody (Biotin)
KB-1686-03 1 mL

Fibrinogen gamma Chain Antibody (Biotin)

Sign In for Pricing
View Details
NSUN3 Blocking Peptide
33R-5271 0.1 mg

NSUN3 Blocking Peptide

Sign In for Pricing
View Details
Human IL-29 (Interleukin 29) QuickTest ELISA Kit
QT-EH0195 96 Tests

Human IL-29 (Interleukin 29) QuickTest ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal KIR2DL1/CD158a Antibody (MM0439-8J29) [DyLight 488]
NBP2-11759G 0.1 mL

Mouse Monoclonal KIR2DL1/CD158a Antibody (MM0439-8J29) [DyLight 488]

Sign In for Pricing
View Details