Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300c Recombinant Protein

Product Specifications

Background

CD300 molecules comprise a family of receptors that regulate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor γ-dependent activation of mast cells and monocytes.

CAS Number

9000-83-3

Swiss Prot

Q08708

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPB41 (NM_001166006) Human Tagged ORF Clone
RC229005 10 µg

EPB41 (NM_001166006) Human Tagged ORF Clone

Sign In for Pricing
View Details
LPL (Lipoprotein lipase) (6F15) Mouse Monoclonal antibody
E28PE0152 100 µL

LPL (Lipoprotein lipase) (6F15) Mouse Monoclonal antibody

Sign In for Pricing
View Details
CXCL4/PF4 polyclonal antibody
BS77247-01 50 µL

CXCL4/PF4 polyclonal antibody

Sign In for Pricing
View Details
CXCL4/PF4 polyclonal antibody
BS77247-02 100 µL

CXCL4/PF4 polyclonal antibody

Sign In for Pricing
View Details
Mouse mmu-miR-8115 miRNA Agomir
abx884479-01 5 nmol

Mouse mmu-miR-8115 miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-8115 miRNA Agomir
abx884479-02 10 nmol

Mouse mmu-miR-8115 miRNA Agomir

Sign In for Pricing
View Details