Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD230 Recombinant Protein

Product Specifications

Background

The PRNP gene encodes the major prion protein (PrP, CD230), a widely-expressed glycoprotein expressed at high levels in the central nervous system. While the typical cellular function of PrP is not well defined, it is a putative antioxidant and a metal-binding protein that may be involved in signal transduction. Prion proteins can adopt different conformations; the cellular PrPc prion protein may be converted following translation into the β-sheet-rich scrapie isoform (PrPsc) responsible for several prion diseases, including bovine spongiform encephalopathy and human Creutzfeldt-Jakob disease. Unlike most neurodegenerative diseases, prion diseases are infectious as prions are capable of propagating by conferring an abnormally folded state onto properly folded cellular proteins. In addition, the cellular PrPc has may be involved in β-amyloid peptide oligomerization and synaptic toxicity.

CAS Number

9000-83-3

Swiss Prot

P04156

Modification Site

NdeI-XhoI

Expression System

Pet-22b (+)

Tag

His-tag

Purity

Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE) .

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~30kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only, not for use in diagnostic procedure.

Host or Source

E.coli

AA Sequence

MKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1565355 Recombinant Protein (Rat)
RP225743 100 µg

RGD1565355 Recombinant Protein (Rat)

Sign In for Pricing
View Details
NPDC-1 discontinued
539840-01 30ul

NPDC-1 discontinued

Sign In for Pricing
View Details
NPDC-1 discontinued
539840-02 100 µL

NPDC-1 discontinued

Sign In for Pricing
View Details
Magic™ Membrane Protein Human EDA2R (Ectodysplasin A2 receptor) Full Length
MPC2511K Each

Magic™ Membrane Protein Human EDA2R (Ectodysplasin A2 receptor) Full Length

Sign In for Pricing
View Details
Jamaicin
HY-124741-01 1 mg

Jamaicin

Sign In for Pricing
View Details
Jamaicin
HY-124741-02 5 mg

Jamaicin

Sign In for Pricing
View Details